PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_282_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family BES1
Protein Properties Length: 234aa    MW: 24650.4 Da    PI: 7.4636
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_282_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF82233.51.5e-1017479150
                              DUF822  79 aeaagssasaspesslqsslkssalaspvesysaspksssfpspssldsislasa..asllpvlsvlslvsssl 150
                                         +ea+++s+++s++sslq s+ ss+++spv+sy+asp+ss  psp++ d + +  +  + +lp+l++l+++++sl
  cra_locus_282_iso_2_len_2381_ver_3   1 MEAGVASTNISTCSSLQPSPLSSSFPSPVPSYHASPSSSLCPSPTRGDGNGNGGNpsSYILPFLRNLASIPNSL 74 
                                         578889******************************************9988877789999*****99998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056874.1E-9367IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009741Biological Processresponse to brassinosteroid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MEAGVASTNI STCSSLQPSP LSSSFPSPVP SYHASPSSSL CPSPTRGDGN GNGGNPSSYI  60
LPFLRNLASI PNSLPPLRIS NSAPVTPPLS SPTRGSKRKP EWEPFSNVQL PSFPHNLFAA  120
SAPSSPTRRR HLKPATIPEC DESDVSTVDS ARWVSFQTTP AAPSSPTFNL IKPASKQNLP  180
VDGCSQFAWG VAPQRGCGSE FAFESGTIKA WEGERAHEIG VDDLELTLGS GKAH
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016557829.11e-97PREDICTED: BES1/BZR1 homolog protein 2-like
SwissprotQ94A431e-63BEH2_ARATH; BES1/BZR1 homolog protein 2
TrEMBLA0A068U2N41e-101A0A068U2N4_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000114707e-87(Solanum tuberosum)